PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G31620.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 298aa    MW: 34010.9 Da    PI: 9.6009
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G31620.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.21.2e-191042234
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-E CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdae 34
                     rienk+ rqvtf+kRrng+lKKA+ELS+LCdae
  OMERI03G31620.5 10 RIENKISRQVTFAKRRNGLLKKAYELSILCDAE 42
                     9******************************97 PP

2SRF-TF87.47.8e-2870119251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
  OMERI03G31620.5  70 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 119
                      9***********************************************96 PP

3K-box91.71.3e-301392345100
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +  + ++ ++++ +qe+ +Lk+ +e Lq++qR+llGedL +L  +eL+qLe+q+ + lk+iRs+K+++ll+++ +l++ke++lq++n+ L++kl
  OMERI03G31620.5 139 DAAAPTSDEMQNNYQEYVNLKAHVEILQQSQRNLLGEDLAPLATNELEQLESQVVRTLKQIRSRKTQVLLDELCDLKRKEQMLQDANRVLKRKL 232
                      444567889************************************************************************************9 PP

            K-box  99 ee 100
                      +e
  OMERI03G31620.5 233 DE 234
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.408142IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-18157IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-18142IPR002100Transcription factor, MADS-box
CDDcd001204.96E-22242No hitNo description
PfamPF003195.9E-171042IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-3661120IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.0261121IPR002100Transcription factor, MADS-box
CDDcd002654.43E-3962139No hitNo description
SuperFamilySSF554551.18E-3062143IPR002100Transcription factor, MADS-box
PROSITE patternPS00350063117IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-296383IPR002100Transcription factor, MADS-box
PfamPF003191.5E-2570117IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-298398IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-2998119IPR002100Transcription factor, MADS-box
PfamPF014861.5E-26145232IPR002487Transcription factor, K-box
PROSITE profilePS5129714.723148238IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AERERERKGR LKRDLEREIE  60
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AEVALVLFSH AGRLYQFSSS  120
SNMLKTLERY QRYIYASQDA AAPTSDEMQN NYQEYVNLKA HVEILQQSQR NLLGEDLAPL  180
ATNELEQLES QVVRTLKQIR SRKTQVLLDE LCDLKRKEQM LQDANRVLKR KLDEIDVEAA  240
PPQPPWNGNC SNGQGGSGVF SSEPPQPEHF FQALGLHAVD VNQPPAPPPG GYPPEWMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-2015323222101Developmental protein SEPALLATA 3
4ox0_B1e-2015323222101Developmental protein SEPALLATA 3
4ox0_C1e-2015323222101Developmental protein SEPALLATA 3
4ox0_D1e-2015323222101Developmental protein SEPALLATA 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14653RKGRLKRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033240.0AB003324.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31254.
GenBankAY5519220.0AY551922.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS217 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631035.11e-151PREDICTED: MADS-box transcription factor 34
SwissprotQ6Q9H61e-153MAD34_ORYSJ; MADS-box transcription factor 34
TrEMBLA0A0E0D6Y00.0A0A0E0D6Y0_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g54170.11e-150(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.14e-74MIKC_MADS family protein